PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 163aa    MW: 17395.9 Da    PI: 12.0639
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002052.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.4e-186699134
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                C++C + +Tp+WR+gp g++tLCnaCG+++++ +
  Do002052.1 66 CTHCASEETPQWRQGPAGPSTLCNACGVRFKSGR 99
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.0186096IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-1560114IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-1463124No hitNo description
Gene3DG3DSA:3.30.50.102.0E-146497IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.41E-1465114No hitNo description
PfamPF003202.5E-166699IPR000679Zinc finger, GATA-type
PROSITE patternPS0034406691IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MAVEVEATPS LPSAGVGRLE VVPHVVGPRT KGLRRRRRVT APWSLPPVLP PPPQPAGGGA  60
APRRRCTHCA SEETPQWRQG PAGPSTLCNA CGVRFKSGRL FPEYRPINSP TFSPLLHSNS  120
HRRVLEMRLH VEEETAAGGG RAGARARRAE RAAARAAAAA QGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987179.14e-65PREDICTED: GATA transcription factor 7
TrEMBLK7WH513e-57K7WH51_MAIZE; Putative GATA transcription factor family protein
STRINGGRMZM2G532534_P018e-57(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.16e-33GATA transcription factor 1